Lineage for d4dg5a_ (4dg5 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183841Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1183842Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1183908Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 1183909Protein automated matches [190573] (3 species)
    not a true protein
  7. 1183916Species Staphylococcus aureus [TaxId:282458] [194064] (1 PDB entry)
  8. 1183917Domain d4dg5a_: 4dg5 A: [194065]
    automated match to d1vpea_

Details for d4dg5a_

PDB Entry: 4dg5 (more details), 2.3 Å

PDB Description: Crystal structure of staphylococcal Phosphoglycerate kinase
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d4dg5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dg5a_ c.86.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
akkivsdldlkgktvlvradfnvplkdgeitndnrivqalptiqyiieqggkivlfshlg
kvkeesdkakltlrpvaedlskkldkevvfvpetrgekleaaikdlkegdvllventrye
dldgkkeskndpelgkywaslgdvfvndafgtahrehasnvgisthletaagflmdkeik
figgvvndphkpvvailggakvsdkinviknlvniadkiiigggmaytflkaqgkeigis
lleedkidfakdllekhgdkivlpvdtkvakefsndakitvvpsdsipadqegmdigpnt
vklfadelegahtvvwngpmgvfefsnfaqgtigvckaianlkdaitiigggdsaaaais
lgfendfthistgggasleylegkelpgikainnk

SCOPe Domain Coordinates for d4dg5a_:

Click to download the PDB-style file with coordinates for d4dg5a_.
(The format of our PDB-style files is described here.)

Timeline for d4dg5a_: