Lineage for d4heqa_ (4heq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587350Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1587460Protein automated matches [190443] (4 species)
    not a true protein
  7. 1587473Species Desulfovibrio gigas [TaxId:879] [194059] (1 PDB entry)
  8. 1587474Domain d4heqa_: 4heq A: [194061]
    automated match to d1fx1a_
    complexed with fmn

Details for d4heqa_

PDB Entry: 4heq (more details), 1.3 Å

PDB Description: The crystal structure of flavodoxin from Desulfovibrio gigas
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d4heqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4heqa_ c.23.5.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
pkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstwg
ddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlva
sslkidgepdsaevldwarevlarv

SCOPe Domain Coordinates for d4heqa_:

Click to download the PDB-style file with coordinates for d4heqa_.
(The format of our PDB-style files is described here.)

Timeline for d4heqa_: