| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
| Protein automated matches [190443] (4 species) not a true protein |
| Species Desulfovibrio gigas [TaxId:879] [194059] (1 PDB entry) |
| Domain d4heqa_: 4heq A: [194061] automated match to d1fx1a_ complexed with fmn |
PDB Entry: 4heq (more details), 1.3 Å
SCOPe Domain Sequences for d4heqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4heqa_ c.23.5.1 (A:) automated matches {Desulfovibrio gigas [TaxId: 879]}
pkalivygsttgntegvaeaiaktlnsegmettvvnvadvtapglaegydvvllgcstwg
ddeielqedfvplyedldraglkdkkvgvfgcgdssytyfcgavdviekkaeelgatlva
sslkidgepdsaevldwarevlarv
Timeline for d4heqa_: