Lineage for d4hszd_ (4hsz D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1268673Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1268674Protein Calcyclin (S100) [47479] (17 species)
  7. 1268758Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (7 PDB entries)
    MTS1 protein
  8. 1268786Domain d4hszd_: 4hsz D: [194058]
    automated match to d1m31a_
    complexed with ca

Details for d4hszd_

PDB Entry: 4hsz (more details), 2.25 Å

PDB Description: Structure of truncated (delta8C) S100A4
PDB Compounds: (D:) Protein S100-A4

SCOPe Domain Sequences for d4hszd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hszd_ a.39.1.2 (D:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
dsnrdnevdfqeycvflsciammcneffeg

SCOPe Domain Coordinates for d4hszd_:

Click to download the PDB-style file with coordinates for d4hszd_.
(The format of our PDB-style files is described here.)

Timeline for d4hszd_: