SCOPe 2.06: Domain d4hszb_: 4hsz B:

Lineage for d4hszb_ (4hsz B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries)
   MTS1 protein

8. Domain d4hszb_: 4hsz B: [194056]
   automated match to d1m31a_
   complexed with ca

Details for d4hszb_

PDB Entry: 4hsz, 2.25 Å

PDB Description: Structure of truncated (delta8C) S100A4

PDB Compounds: (B:) Protein S100-A4

SCOPe Domain Sequences for d4hszb_:

Sequence; same for both SEQRES and ATOM records:

>d4hszb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
cplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnl
dsnrdnevdfqeycvflsciammcneffeg

Timeline for d4hszb_:

• d4hszb_ first appeared in SCOPe 2.02
  
• d4hszb_ appears in SCOPe 2.05
  
• d4hszb_ appears in SCOPe 2.07
  
• d4hszb_ appears in the current release, SCOPe 2.08