Lineage for d3vb2b_ (3vb2 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307134Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2307234Protein automated matches [190294] (6 species)
    not a true protein
  7. 2307239Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries)
  8. 2307241Domain d3vb2b_: 3vb2 B: [194053]
    automated match to d1jgsa_

Details for d3vb2b_

PDB Entry: 3vb2 (more details), 2.6 Å

PDB Description: Crystal Structure of the Reduced Form of MarR from E.coli
PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d3vb2b_:

Sequence, based on SEQRES records: (download)

>d3vb2b_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvl
svdlgaltrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqelt
knltadevatleyllkkvlp

Sequence, based on observed residues (ATOM records): (download)

>d3vb2b_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvl
svdlgaltrmldrlvskgwverlpnvlvklttggaaiseqshqlvgqdlhqeltknltad
evatleyllkkvlp

SCOPe Domain Coordinates for d3vb2b_:

Click to download the PDB-style file with coordinates for d3vb2b_.
(The format of our PDB-style files is described here.)

Timeline for d3vb2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vb2a_