SCOPe 2.02: Domain d3vb2b_: 3vb2 B:

Lineage for d3vb2b_ (3vb2 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [193218] (3 PDB entries)

8. Domain d3vb2b_: 3vb2 B: [194053]
   automated match to d1jgsa_

Details for d3vb2b_

PDB Entry: 3vb2, 2.6 Å

PDB Description: Crystal Structure of the Reduced Form of MarR from E.coli

PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d3vb2b_:

Sequence, based on SEQRES records:

>d3vb2b_ a.4.5.28 (B:) automated matches {Escherichia coli [TaxId: 83333]}
sdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvl
svdlgaltrmldrlvskgwverlpnpndkrgvlvklttggaaiseqshqlvgqdlhqelt
knltadevatleyllkkvlp

Sequence, based on observed residues (ATOM records):

>d3vb2b_ a.4.5.28 (B:) automated matches {Escherichia coli [TaxId: 83333]}
sdlfneiiplgrlihmvnqkkdrllneylsplditaaqfkvlssirsaasitpvelkkvl
svdlgaltrmldrlvskgwverlpnvlvklttggaaiseqshqlvgqdlhqeltknltad
evatleyllkkvlp

Timeline for d3vb2b_:

• d3vb2b_ is new in SCOPe 2.02-stable
  
• d3vb2b_ appears in SCOPe 2.03
  
• d3vb2b_ appears in the current release, SCOPe 2.08