Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.1: DNase I-like [56220] (7 proteins) |
Protein Deoxyribonuclease I [56225] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries) |
Domain d3w3db_: 3w3d B: [194052] Other proteins in same PDB: d3w3da1, d3w3da2 automated match to d2a40b_ complexed with atp, ca |
PDB Entry: 3w3d (more details), 1.8 Å
SCOPe Domain Sequences for d3w3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w3db_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg lsnemalaisdhypvevtlt
Timeline for d3w3db_: