Lineage for d3w3db_ (3w3d B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988149Protein Deoxyribonuclease I [56225] (1 species)
  7. 2988150Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 2988154Domain d3w3db_: 3w3d B: [194052]
    Other proteins in same PDB: d3w3da1, d3w3da2
    automated match to d2a40b_
    complexed with atp, ca

Details for d3w3db_

PDB Entry: 3w3d (more details), 1.8 Å

PDB Description: crystal structure of smooth muscle g actin dnase i complex
PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d3w3db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w3db_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOPe Domain Coordinates for d3w3db_:

Click to download the PDB-style file with coordinates for d3w3db_.
(The format of our PDB-style files is described here.)

Timeline for d3w3db_: