| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
| Domain d4b8zd_: 4b8z D: [194050] Other proteins in same PDB: d4b8zb2 automated match to d1bsva_ complexed with gdp, nap |
PDB Entry: 4b8z (more details), 2.75 Å
SCOPe Domain Sequences for d4b8zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b8zd_ c.2.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi
hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid
etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv
lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee
devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke
tcawftdnyeqar
Timeline for d4b8zd_:
View in 3DDomains from other chains: (mouse over for more information) d4b8za_, d4b8zb1, d4b8zb2, d4b8zc_ |