Lineage for d1fuqa_ (1fuq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010329Protein Fumarase [48561] (3 species)
  7. 2010332Species Escherichia coli [TaxId:562] [48562] (6 PDB entries)
  8. 2010339Domain d1fuqa_: 1fuq A: [19405]
    complexed with cit, sif

Details for d1fuqa_

PDB Entry: 1fuq (more details), 2 Å

PDB Description: fumarase with bound 3-trimethylsilylsuccinic acid
PDB Compounds: (A:) fumarase c

SCOPe Domain Sequences for d1fuqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuqa_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]}
vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
iakkahkegltlkaaalalgylseaefdswvrpeqm

SCOPe Domain Coordinates for d1fuqa_:

Click to download the PDB-style file with coordinates for d1fuqa_.
(The format of our PDB-style files is described here.)

Timeline for d1fuqa_: