Lineage for d4eonc1 (4eon C:1-297)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980461Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2980462Species Human (Homo sapiens) [TaxId:9606] [88856] (417 PDB entries)
    Uniprot P24941
  8. 2980794Domain d4eonc1: 4eon C:1-297 [194039]
    Other proteins in same PDB: d4eona2, d4eonb1, d4eonb2, d4eonc2, d4eond1, d4eond2
    automated match to d3bhta_
    complexed with 1ro, mg

Details for d4eonc1

PDB Entry: 4eon (more details), 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, q131e - human cyclin a3 complex with the inhibitor ro3306
PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eonc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eonc1 d.144.1.7 (C:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d4eonc1:

Click to download the PDB-style file with coordinates for d4eonc1.
(The format of our PDB-style files is described here.)

Timeline for d4eonc1: