Lineage for d1fura_ (1fur A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010329Protein Fumarase [48561] (3 species)
  7. 2010332Species Escherichia coli [TaxId:562] [48562] (6 PDB entries)
  8. 2010333Domain d1fura_: 1fur A: [19403]
    complexed with mlt; mutant

Details for d1fura_

PDB Entry: 1fur (more details), 1.95 Å

PDB Description: fumarase mutant h188n with bound substrate l-malate at putative activator site
PDB Compounds: (A:) fumarase c

SCOPe Domain Sequences for d1fura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fura_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]}
vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
igrtnlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
iakkahkegltlkaaalalgylseaefdswvrpeqm

SCOPe Domain Coordinates for d1fura_:

Click to download the PDB-style file with coordinates for d1fura_.
(The format of our PDB-style files is described here.)

Timeline for d1fura_: