Lineage for d4hbpb_ (4hbp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150439Protein automated matches [191046] (2 species)
    not a true protein
  7. 2150440Species Norway rat (Rattus norvegicus) [TaxId:10116] [188885] (19 PDB entries)
  8. 2150476Domain d4hbpb_: 4hbp B: [194027]
    automated match to d2wapb_
    complexed with 17j

Details for d4hbpb_

PDB Entry: 4hbp (more details), 2.91 Å

PDB Description: Crystal Structure of FAAH in complex with inhibitor
PDB Compounds: (B:) fatty-acid amide hydrolase 1

SCOPe Domain Sequences for d4hbpb_:

Sequence, based on SEQRES records: (download)

>d4hbpb_ c.117.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmtpqk
q

Sequence, based on observed residues (ATOM records): (download)

>d4hbpb_ c.117.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
fftylgkawevnkgtncvtsyltdcaprqgllygvpvslkecfsykghdstlglslnegm
psesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspggssggeg
aligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtavqlslgp
mardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnytmpspam
rralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdfvdpclg
dlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrqsviaqw
kamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaeddaqmel
ykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmtpqkq

SCOPe Domain Coordinates for d4hbpb_:

Click to download the PDB-style file with coordinates for d4hbpb_.
(The format of our PDB-style files is described here.)

Timeline for d4hbpb_: