Lineage for d3ut3c_ (3ut3 C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568293Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2568294Species Human (Homo sapiens) [TaxId:9606] [56588] (16 PDB entries)
  8. 2568304Domain d3ut3c_: 3ut3 C: [194021]
    automated match to d1a7ca_
    complexed with emj

Details for d3ut3c_

PDB Entry: 3ut3 (more details), 2.42 Å

PDB Description: A novel PAI-I inhibitor and its structural mechanism
PDB Compounds: (C:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d3ut3c_:

Sequence, based on SEQRES records: (download)

>d3ut3c_ e.1.1.1 (C:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
tgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d3ut3c_ e.1.1.1 (C:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
tslsdqeplhvalalqkvkievnesgtvavivsarmapeeiiidrpflfvvrhnptgtvl
fmgqvmep

SCOPe Domain Coordinates for d3ut3c_:

Click to download the PDB-style file with coordinates for d3ut3c_.
(The format of our PDB-style files is described here.)

Timeline for d3ut3c_: