Lineage for d1jswd_ (1jsw D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6564Protein L-aspartate ammonia lyase [48559] (1 species)
  7. 6565Species Escherichia coli [TaxId:562] [48560] (1 PDB entry)
  8. 6569Domain d1jswd_: 1jsw D: [19402]

Details for d1jswd_

PDB Entry: 1jsw (more details), 2.8 Å

PDB Description: native l-aspartate ammonia lyase

SCOP Domain Sequences for d1jswd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jswd_ a.127.1.1 (D:) L-aspartate ammonia lyase {Escherichia coli}
msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
hhngdivgkicaetgksvrevvlergllteaelddifsv

SCOP Domain Coordinates for d1jswd_:

Click to download the PDB-style file with coordinates for d1jswd_.
(The format of our PDB-style files is described here.)

Timeline for d1jswd_: