Lineage for d3w4uc_ (3w4u C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686972Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (2 PDB entries)
  8. 2686976Domain d3w4uc_: 3w4u C: [194018]
    Other proteins in same PDB: d3w4ub_, d3w4ud_, d3w4uf_
    automated match to d1jeba_
    complexed with cmo, hem

Details for d3w4uc_

PDB Entry: 3w4u (more details), 1.95 Å

PDB Description: Human zeta-2 beta-2-s hemoglobin
PDB Compounds: (C:) Hemoglobin subunit zeta

SCOPe Domain Sequences for d3w4uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w4uc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]}
sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
ahaawdkflsvvssvltekyr

SCOPe Domain Coordinates for d3w4uc_:

Click to download the PDB-style file with coordinates for d3w4uc_.
(The format of our PDB-style files is described here.)

Timeline for d3w4uc_: