Lineage for d3w4ue_ (3w4u E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2300436Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (2 PDB entries)
  8. 2300441Domain d3w4ue_: 3w4u E: [194016]
    Other proteins in same PDB: d3w4ub_, d3w4ud_, d3w4uf_
    automated match to d1jeba_
    complexed with cmo, hem

Details for d3w4ue_

PDB Entry: 3w4u (more details), 1.95 Å

PDB Description: Human zeta-2 beta-2-s hemoglobin
PDB Compounds: (E:) Hemoglobin subunit zeta

SCOPe Domain Sequences for d3w4ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w4ue_ a.1.1.2 (E:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]}
sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
ahaawdkflsvvssvlte

SCOPe Domain Coordinates for d3w4ue_:

Click to download the PDB-style file with coordinates for d3w4ue_.
(The format of our PDB-style files is described here.)

Timeline for d3w4ue_: