![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (22 species) |
![]() | Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (2 PDB entries) |
![]() | Domain d3w4ue_: 3w4u E: [194016] Other proteins in same PDB: d3w4ub_, d3w4ud_, d3w4uf_ automated match to d1jeba_ complexed with cmo, hem |
PDB Entry: 3w4u (more details), 1.95 Å
SCOPe Domain Sequences for d3w4ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w4ue_ a.1.1.2 (E:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae ahaawdkflsvvssvlte
Timeline for d3w4ue_: