Lineage for d4d8sa_ (4d8s A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802584Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1802585Protein automated matches [190692] (11 species)
    not a true protein
  7. 1802609Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)
  8. 1802637Domain d4d8sa_: 4d8s A: [194015]
    automated match to d2htua_
    complexed with 0hx, ca

Details for d4d8sa_

PDB Entry: 4d8s (more details), 2.4 Å

PDB Description: influenza na in complex with antiviral compound
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4d8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8sa_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdid

SCOPe Domain Coordinates for d4d8sa_:

Click to download the PDB-style file with coordinates for d4d8sa_.
(The format of our PDB-style files is described here.)

Timeline for d4d8sa_: