Lineage for d1jswc_ (1jsw C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217746Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 217747Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 217748Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 217808Protein L-aspartate ammonia lyase [48559] (1 species)
  7. 217809Species Escherichia coli [TaxId:562] [48560] (1 PDB entry)
  8. 217812Domain d1jswc_: 1jsw C: [19401]

Details for d1jswc_

PDB Entry: 1jsw (more details), 2.8 Å

PDB Description: native l-aspartate ammonia lyase

SCOP Domain Sequences for d1jswc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jswc_ a.127.1.1 (C:) L-aspartate ammonia lyase {Escherichia coli}
irieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaamanke
lqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlaniglelmgh
qkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkavefqdi
lkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtglntpke
ysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrllssg
praglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlqlnvm
epvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnp

SCOP Domain Coordinates for d1jswc_:

Click to download the PDB-style file with coordinates for d1jswc_.
(The format of our PDB-style files is described here.)

Timeline for d1jswc_: