![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
![]() | Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
![]() | Protein automated matches [193225] (4 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries) |
![]() | Domain d4j10b_: 4j10 B: [194005] automated match to d3favc_ complexed with fmt |
PDB Entry: 4j10 (more details), 1.44 Å
SCOPe Domain Sequences for d4j10b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j10b_ a.25.3.0 (B:) automated matches {Bacillus anthracis [TaxId: 260799]} ikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskqamq qyipilegistdlkriadkfrn
Timeline for d4j10b_: