| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
| Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
| Protein automated matches [193225] (4 species) not a true protein |
| Species Bacillus anthracis [TaxId:260799] [193226] (10 PDB entries) |
| Domain d4j10a_: 4j10 A: [194004] automated match to d3favc_ complexed with fmt |
PDB Entry: 4j10 (more details), 1.44 Å
SCOPe Domain Sequences for d4j10a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j10a_ a.25.3.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
maeikitpeeleriagnfknaageaqsqinrlegdinslegqwagatqakfrgefiqskq
amqqyipilegistdlkriadkfrntdn
Timeline for d4j10a_: