Lineage for d1jswb_ (1jsw B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156518Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 156519Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 156520Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 156580Protein L-aspartate ammonia lyase [48559] (1 species)
  7. 156581Species Escherichia coli [TaxId:562] [48560] (1 PDB entry)
  8. 156583Domain d1jswb_: 1jsw B: [19400]

Details for d1jswb_

PDB Entry: 1jsw (more details), 2.8 Å

PDB Description: native l-aspartate ammonia lyase

SCOP Domain Sequences for d1jswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jswb_ a.127.1.1 (B:) L-aspartate ammonia lyase {Escherichia coli}
msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
hhngdivgkicaetgksvrevvlergllteaelddifsvq

SCOP Domain Coordinates for d1jswb_:

Click to download the PDB-style file with coordinates for d1jswb_.
(The format of our PDB-style files is described here.)

Timeline for d1jswb_: