Lineage for d1jswb_ (1jsw B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010348Protein L-aspartate ammonia lyase [48559] (2 species)
  7. 2010368Species Escherichia coli [TaxId:562] [48560] (1 PDB entry)
  8. 2010370Domain d1jswb_: 1jsw B: [19400]
    complexed with act, bgc

Details for d1jswb_

PDB Entry: 1jsw (more details), 2.7 Å

PDB Description: native l-aspartate ammonia lyase
PDB Compounds: (B:) l-aspartate ammonia-lyase

SCOPe Domain Sequences for d1jswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jswb_ a.127.1.1 (B:) L-aspartate ammonia lyase {Escherichia coli [TaxId: 562]}
msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
hhngdivgkicaetgksvrevvlergllteaelddifsvq

SCOPe Domain Coordinates for d1jswb_:

Click to download the PDB-style file with coordinates for d1jswb_.
(The format of our PDB-style files is described here.)

Timeline for d1jswb_: