Lineage for d3uleg_ (3ule G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340383Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 2340384Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 2340390Protein automated matches [190348] (1 species)
    not a true protein
  7. 2340391Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 2340393Domain d3uleg_: 3ule G: [193999]
    Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3uled1, d3uled2, d3ulee_, d3ulef_
    automated match to d3dxkg_
    complexed with atp, c69, ca

Details for d3uleg_

PDB Entry: 3ule (more details), 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3uleg_:

Sequence, based on SEQRES records: (download)

>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d3uleg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeeagpdegevdsclrqgnmtaalqaalknppintksqavkdr
agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
aggvgsivrvltarktv

SCOPe Domain Coordinates for d3uleg_:

Click to download the PDB-style file with coordinates for d3uleg_.
(The format of our PDB-style files is described here.)

Timeline for d3uleg_: