Lineage for d3vqza_ (3vqz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231713Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2231714Protein automated matches [190418] (18 species)
    not a true protein
  7. 2231907Species Serratia marcescens [TaxId:615] [193993] (7 PDB entries)
  8. 2231911Domain d3vqza_: 3vqz A: [193995]
    automated match to d2gmna1
    complexed with mcr, na, zn

Details for d3vqza_

PDB Entry: 3vqz (more details), 2.2 Å

PDB Description: Crystal structure of metallo-beta-lactamase, SMB-1, in a complex with mercaptoacetic acid
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d3vqza_:

Sequence, based on SEQRES records: (download)

>d3vqza_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasek

Sequence, based on observed residues (ATOM records): (download)

>d3vqza_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgsnfpgsa
kvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsadsy
rfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngacra
iaaagrkrletrlasek

SCOPe Domain Coordinates for d3vqza_:

Click to download the PDB-style file with coordinates for d3vqza_.
(The format of our PDB-style files is described here.)

Timeline for d3vqza_: