![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (15 species) not a true protein |
![]() | Species Serratia marcescens [TaxId:615] [193993] (2 PDB entries) |
![]() | Domain d3vpea_: 3vpe A: [193994] automated match to d2gmna1 complexed with act, gol, so4, zn |
PDB Entry: 3vpe (more details), 1.6 Å
SCOPe Domain Sequences for d3vpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpea_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]} rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac raiaaagrkrletrlasek
Timeline for d3vpea_: