Lineage for d3vpea_ (3vpe A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679746Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1679747Protein automated matches [190418] (12 species)
    not a true protein
  7. 1679874Species Serratia marcescens [TaxId:615] [193993] (2 PDB entries)
  8. 1679875Domain d3vpea_: 3vpe A: [193994]
    automated match to d2gmna1
    complexed with act, gol, so4, zn

Details for d3vpea_

PDB Entry: 3vpe (more details), 1.6 Å

PDB Description: Crystal Structure of Metallo-beta-Lactamase SMB-1
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d3vpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpea_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasek

SCOPe Domain Coordinates for d3vpea_:

Click to download the PDB-style file with coordinates for d3vpea_.
(The format of our PDB-style files is described here.)

Timeline for d3vpea_: