Lineage for d3ziaq_ (3zia Q:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603561Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1603709Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1603740Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 1603741Protein automated matches [190687] (2 species)
    not a true protein
  7. 1603744Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries)
  8. 1603746Domain d3ziaq_: 3zia Q: [193992]
    Other proteins in same PDB: d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3
    automated match to d2hldg_
    complexed with adp, atp, edo, mg

Details for d3ziaq_

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (Q:) ATP synthase subunit gamma, mitochondrial

SCOPe Domain Sequences for d3ziaq_:

Sequence, based on SEQRES records: (download)

>d3ziaq_ c.49.2.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d3ziaq_ c.49.2.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
silynrtrqavitnelvdiitgass

SCOPe Domain Coordinates for d3ziaq_:

Click to download the PDB-style file with coordinates for d3ziaq_.
(The format of our PDB-style files is described here.)

Timeline for d3ziaq_: