Lineage for d3zjkb_ (3zjk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083156Species Thermus thermophilus [TaxId:274] [193989] (1 PDB entry)
  8. 2083158Domain d3zjkb_: 3zjk B: [193991]
    automated match to d1np2a_
    complexed with cl, gol; mutant

Details for d3zjkb_

PDB Entry: 3zjk (more details), 2.2 Å

PDB Description: crystal structure of Ttb-gly F401S mutant
PDB Compounds: (B:) beta glycosidase

SCOPe Domain Sequences for d3zjkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zjkb_ c.1.8.4 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
ekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedial
mqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpla
leerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnl
eaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffldp
ilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylppeg
patamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayleah
veaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsalwyrer
iar

SCOPe Domain Coordinates for d3zjkb_:

Click to download the PDB-style file with coordinates for d3zjkb_.
(The format of our PDB-style files is described here.)

Timeline for d3zjkb_: