Lineage for d1jswa_ (1jsw A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51054Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 51055Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 51056Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 51108Protein L-aspartate ammonia lyase [48559] (1 species)
  7. 51109Species Escherichia coli [TaxId:562] [48560] (1 PDB entry)
  8. 51110Domain d1jswa_: 1jsw A: [19399]

Details for d1jswa_

PDB Entry: 1jsw (more details), 2.8 Å

PDB Description: native l-aspartate ammonia lyase

SCOP Domain Sequences for d1jswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jswa_ a.127.1.1 (A:) L-aspartate ammonia lyase {Escherichia coli}
msnnirieedllgtrevpadayygvhtlraienfyisnnkisdipefvrgmvmvkkaaam
ankelqtipksvanaiiaacdevlnngkcmdqfpvdvyqggagtsvnmntnevlanigle
lmghqkgeyqylnpndhvnkcqstndayptgfriavyssliklvdainqlregferkave
fqdilkmgrtqlqdavpmtlgqefrafsillkeevkniqrtaelllevnlgataigtgln
tpkeysplavkklaevtgfpcvpaedlieatsdcgayvmvhgalkrlavkmskicndlrl
lssgpraglneinlpelqagssimpakvnpvvpevvnqvcfkvigndttvtmaaeagqlq
lnvmepvigqamfesvhiltnacynllekcingitankevcegyvynsigivtylnpfig
hhngdivgkicaetgksvrevvlergllteaelddifsv

SCOP Domain Coordinates for d1jswa_:

Click to download the PDB-style file with coordinates for d1jswa_.
(The format of our PDB-style files is described here.)

Timeline for d1jswa_: