Lineage for d4i8qa_ (4i8q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141640Species Solanum lycopersicum [TaxId:4081] [193976] (2 PDB entries)
  8. 2141643Domain d4i8qa_: 4i8q A: [193978]
    automated match to d3iwja_
    complexed with edo, na, nad, peg; mutant

Details for d4i8qa_

PDB Entry: 4i8q (more details), 2.65 Å

PDB Description: Structure of the aminoaldehyde dehydrogenase 1 E260A mutant from Solanum lycopersicum (SlAMADH1-E260A)
PDB Compounds: (A:) Putative betaine aldehyde dehyrogenase

SCOPe Domain Sequences for d4i8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i8qa_ c.82.1.0 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
piprrqlyiggewrepvkknripiinpateeiigdipaataedvdiaveaarkaiarddw
gsttgaqrakylraiaakvlekksvlatlesldsgktlyesaadmddvagcfeyyaglae
aldsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllmaiwkvapalaagcaailkp
selasitclelgeicreiglpsgalniltglgpeaggplashphvdkisftgsgptgski
mtaaaqlvkpvslalggkspivvfddidnldiaaewtlfgifantgqvcsatsrlivqen
iasafmdrllkwtknikisdpleedcklgpvvsagqyekvlkfisnaksegatilcgger
pqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkteeqaielandtkyglgaav
mskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsgfgrdlgkwglenflnikqv
teytsaeplafyksp

SCOPe Domain Coordinates for d4i8qa_:

Click to download the PDB-style file with coordinates for d4i8qa_.
(The format of our PDB-style files is described here.)

Timeline for d4i8qa_: