SCOPe 2.02: Domain d4irob_: 4iro B:

Lineage for d4irob_ (4iro B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (10 PDB entries)

8. Domain d4irob_: 4iro B: [193973]
   Other proteins in same PDB: d4iroc_
   automated match to d2h8fb_
   complexed with cmo, hem

Details for d4irob_

PDB Entry: 4iro, 2.2 Å

PDB Description: Crystal structure of T-state carbonmonoxy hemoglobin from Trematomus bernacchii at pH 8.4

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4irob_:

Sequence; same for both SEQRES and ATOM records:

>d4irob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d4irob_:

• d4irob_ is new in SCOPe 2.02-stable
  
• d4irob_ appears in SCOPe 2.03
  
• d4irob_ appears in the current release, SCOPe 2.08