Class b: All beta proteins [48724] (174 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein automated matches [190387] (2 species) not a true protein |
Domain d4akda_: 4akd A: [193968] automated match to d1vboa_ complexed with cd, cl |
PDB Entry: 4akd (more details), 2.1 Å
SCOPe Domain Sequences for d4akda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akda_ b.77.3.1 (A:) automated matches {Artocarpus integer [TaxId: 3490]} masqtitvgpwggsggngwddgsytgirqielsykeaigsfcviydlngesfpgpkhtsk lpyknvkielqfpeeflvsvsgytgpfsalatptpvvrsltfktnkgrtfgpygdeegty fnlpienglivgfkgrtgdlldaigvhmal
Timeline for d4akda_: