Lineage for d4duka_ (4duk A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173859Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1174003Family c.56.5.2: Carboxypeptidase T [53198] (2 proteins)
  6. 1174007Protein automated matches [191261] (1 species)
    not a true protein
  7. 1174008Species Thermoactinomyces vulgaris [TaxId:2026] [189824] (4 PDB entries)
  8. 1174011Domain d4duka_: 4duk A: [193964]
    automated match to d1obra_
    complexed with bzs, ca, gol, so4, zn

Details for d4duka_

PDB Entry: 4duk (more details), 1.57 Å

PDB Description: carboxypeptidase t with l-benzylsuccinic acid
PDB Compounds: (A:) carboxypeptidase t

SCOPe Domain Sequences for d4duka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duka_ c.56.5.2 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
aqtngytpqqasdlyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
nkeavlyvaekadcpysvigksc

SCOPe Domain Coordinates for d4duka_:

Click to download the PDB-style file with coordinates for d4duka_.
(The format of our PDB-style files is described here.)

Timeline for d4duka_: