Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Artificial gene [TaxId:32630] [193962] (4 PDB entries) |
Domain d4duia_: 4dui A: [193963] automated match to d3q9nd_ complexed with mpd, mrd |
PDB Entry: 4dui (more details), 1.16 Å
SCOPe Domain Sequences for d4duia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duia_ d.211.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]} hhhhhhgsdlgkklleaaragqddevrilmangadvnatdasgltplhlaatyghleive vllkhgadvnaidimgstplhlaalighleivevllkhgadvnavdtwgdtplhlaaimg hleivevllkhgadvnaqdkfgktafdisidngnedlaeilqkln
Timeline for d4duia_: