Lineage for d4dvrg_ (4dvr G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941821Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1941822Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1941823Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1941849Protein automated matches [190166] (2 species)
    not a true protein
  7. 1941857Species Human immunodeficiency virus type 1 (isolate yu2) [TaxId:362651] [193960] (1 PDB entry)
  8. 1941858Domain d4dvrg_: 4dvr G: [193961]
    Other proteins in same PDB: d4dvrh1, d4dvrh2, d4dvrl1, d4dvrl2
    automated match to d3hi1g_
    complexed with 0ly, nag

Details for d4dvrg_

PDB Entry: 4dvr (more details), 2.5 Å

PDB Description: crystal structure of yu2 gp120 core in complex with fab 48d and nbd- 557
PDB Compounds: (G:) glycoprotein gp120

SCOPe Domain Sequences for d4dvrg_:

Sequence, based on SEQRES records: (download)

>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnggsgsggdirqahcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

Sequence, based on observed residues (ATOM records): (download)

>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnngdirqahcnlsktqwentleqiaiklkeqfgnnktiifnps
sggdpeivthsfncggeffycnstqlftwndtrnitlpcrikqiinmwqevgkamyappi
rgqircssnitgllltrdngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d4dvrg_:

Click to download the PDB-style file with coordinates for d4dvrg_.
(The format of our PDB-style files is described here.)

Timeline for d4dvrg_: