![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.172: gp120 core [56501] (1 superfamily) unusual fold |
![]() | Superfamily d.172.1: gp120 core [56502] (1 family) ![]() |
![]() | Family d.172.1.1: gp120 core [56503] (2 proteins) |
![]() | Protein automated matches [190166] (2 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 (isolate yu2) [TaxId:362651] [193960] (1 PDB entry) |
![]() | Domain d4dvrg_: 4dvr G: [193961] Other proteins in same PDB: d4dvrh1, d4dvrh2, d4dvrl1, d4dvrl2 automated match to d3hi1g_ complexed with 0ly, nag |
PDB Entry: 4dvr (more details), 2.5 Å
SCOPe Domain Sequences for d4dvrg_:
Sequence, based on SEQRES records: (download)
>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]} tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak tiivqlnesvvinctrpnnggsgsggdirqahcnlsktqwentleqiaiklkeqfgnnkt iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky kvvkie
>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]} tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak tiivqlnesvvinctrpnngdirqahcnlsktqwentleqiaiklkeqfgnnktiifnps sggdpeivthsfncggeffycnstqlftwndtrnitlpcrikqiinmwqevgkamyappi rgqircssnitgllltrdngteifrpgggdmrdnwrselykykvvkie
Timeline for d4dvrg_:
![]() Domains from other chains: (mouse over for more information) d4dvrh1, d4dvrh2, d4dvrl1, d4dvrl2 |