Lineage for d4dvrg_ (4dvr G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227223Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1227224Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1227225Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1227251Protein automated matches [190166] (2 species)
    not a true protein
  7. 1227258Species Human immunodeficiency virus type 1 (isolate yu2) [TaxId:362651] [193960] (1 PDB entry)
  8. 1227259Domain d4dvrg_: 4dvr G: [193961]
    automated match to d3hi1g_
    complexed with 0ly, nag

Details for d4dvrg_

PDB Entry: 4dvr (more details), 2.5 Å

PDB Description: crystal structure of yu2 gp120 core in complex with fab 48d and nbd- 557
PDB Compounds: (G:) envelope glycoprotein gp160

SCOPe Domain Sequences for d4dvrg_:

Sequence, based on SEQRES records: (download)

>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnggsgsggdirqahcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

Sequence, based on observed residues (ATOM records): (download)

>d4dvrg_ d.172.1.1 (G:) automated matches {Human immunodeficiency virus type 1 (isolate yu2) [TaxId: 362651]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnngdirqahcnlsktqwentleqiaiklkeqfgnnktiifnps
sggdpeivthsfncggeffycnstqlftwndtrnitlpcrikqiinmwqevgkamyappi
rgqircssnitgllltrdngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d4dvrg_:

Click to download the PDB-style file with coordinates for d4dvrg_.
(The format of our PDB-style files is described here.)

Timeline for d4dvrg_: