Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.8: RPF-like [159824] (2 proteins) Pfam PF06737; Transglycosylase-like domain |
Protein automated matches [193952] (1 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries) |
Domain d4emnd_: 4emn D: [193955] automated match to d1xsfa1 complexed with ben, so4 |
PDB Entry: 4emn (more details), 1.17 Å
SCOPe Domain Sequences for d4emnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4emnd_ d.2.1.8 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev trlrqgwgawpvcaaragar
Timeline for d4emnd_: