Lineage for d1e7bb3 (1e7b B:389-580)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6463Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 6464Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 6465Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 6466Protein Serum albumin [48554] (1 species)
  7. 6467Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries)
  8. Domain d1e7bb3: 1e7b B:389-580 [19395]

Details for d1e7bb3

PDB Entry: 1e7b (more details), 2.38 Å

PDB Description: crystal structure of human serum albumin complexed with the general anesthetic halothane

SCOP Domain Sequences for d1e7bb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7bb3 a.126.1.1 (B:389-580) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasq

SCOP Domain Coordinates for d1e7bb3 are not available.

Timeline for d1e7bb3:

Domains from same chain:
(mouse over for more information)
d1e7bb1, d1e7bb2
Domains from other chains:
(mouse over for more information)
d1e7ba1, d1e7ba2, d1e7ba3