Lineage for d4g01b_ (4g01 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868753Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)
  8. 2868756Domain d4g01b_: 4g01 B: [193949]
    automated match to d2efhb_
    complexed with ca, gdp

Details for d4g01b_

PDB Entry: 4g01 (more details), 2.2 Å

PDB Description: ara7-gdp-ca2+/vps9a
PDB Compounds: (B:) Ras-related protein RABF2b

SCOPe Domain Sequences for d4g01b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g01b_ c.37.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

SCOPe Domain Coordinates for d4g01b_:

Click to download the PDB-style file with coordinates for d4g01b_.
(The format of our PDB-style files is described here.)

Timeline for d4g01b_: