SCOPe 2.08: Domain d4awxb1: 4awx B:1-79

Lineage for d4awxb1 (4awx B:1-79)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins)
   automatically mapped to Pfam PF09012

6. Protein automated matches [193941] (2 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [193942] (1 PDB entry)

8. Domain d4awxb1: 4awx B:1-79 [193943]
   Other proteins in same PDB: d4awxa_, d4awxb2, d4awxb3
   automated match to d1xn7a_
   complexed with ni, so4

Details for d4awxb1

PDB Entry: 4awx, 2.3 Å

PDB Description: Moonlighting functions of FeoC in the regulation of ferrous iron transport in Feo

PDB Compounds: (B:) Ferrous iron transport protein C

SCOPe Domain Sequences for d4awxb1:

Sequence, based on SEQRES records:

>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalr

Sequence, based on observed residues (ATOM records):

>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvriseqewwalr

Timeline for d4awxb1:

• d4awxb1 first appeared in SCOPe 2.02, called d4awxb_
  
• d4awxb1 appears in SCOPe 2.07