Lineage for d4awxb1 (4awx B:1-79)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694324Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins)
    automatically mapped to Pfam PF09012
  6. 2694328Protein automated matches [193941] (2 species)
    not a true protein
  7. 2694329Species Klebsiella pneumoniae [TaxId:573] [193942] (1 PDB entry)
  8. 2694330Domain d4awxb1: 4awx B:1-79 [193943]
    Other proteins in same PDB: d4awxa_, d4awxb2, d4awxb3
    automated match to d1xn7a_
    complexed with ni, so4

Details for d4awxb1

PDB Entry: 4awx (more details), 2.3 Å

PDB Description: Moonlighting functions of FeoC in the regulation of ferrous iron transport in Feo
PDB Compounds: (B:) Ferrous iron transport protein C

SCOPe Domain Sequences for d4awxb1:

Sequence, based on SEQRES records: (download)

>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalr

Sequence, based on observed residues (ATOM records): (download)

>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvriseqewwalr

SCOPe Domain Coordinates for d4awxb1:

Click to download the PDB-style file with coordinates for d4awxb1.
(The format of our PDB-style files is described here.)

Timeline for d4awxb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4awxa_