| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins) automatically mapped to Pfam PF09012 |
| Protein automated matches [193941] (2 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:573] [193942] (1 PDB entry) |
| Domain d4awxb1: 4awx B:1-79 [193943] Other proteins in same PDB: d4awxa_, d4awxb2, d4awxb3 automated match to d1xn7a_ complexed with ni, so4 |
PDB Entry: 4awx (more details), 2.3 Å
SCOPe Domain Sequences for d4awxb1:
Sequence, based on SEQRES records: (download)
>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvrisetsegclsgs
ckscpegkaacrqewwalr
>d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}
maslmevrdmlalqgrmeakqlsarlqtpqplidamlermeamgkvvriseqewwalr
Timeline for d4awxb1: