Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (4 species) not a true protein |
Species Peanut (Arachis hypogaea) [TaxId:3818] [193926] (1 PDB entry) |
Domain d4espa_: 4esp A: [193927] automated match to d1g5ua_ complexed with edo, ipa |
PDB Entry: 4esp (more details), 1.1 Å
SCOPe Domain Sequences for d4espa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4espa_ d.110.1.1 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} swqtyvddhllceiegnhlssaailgqdgsvwaqssnfpqfkpeeitaimndfaepgsla ptglylggtkymviqgepgtvirgkkgpggvtikktnqaliigiydepmtpgqcnmivek lgdylidtgl
Timeline for d4espa_: