![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein automated matches [190531] (23 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [193921] (2 PDB entries) |
![]() | Domain d4f0ta_: 4f0t A: [193924] automated match to d1ha7a_ complexed with cyc |
PDB Entry: 4f0t (more details), 2.25 Å
SCOPe Domain Sequences for d4f0ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f0ta_ a.1.1.3 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]} mktplteavstadsqgrflsstelqiafgrlrqanaglqaakaltdnaqslvngaaqavy nkfpyttqtqgnnfaadqrgkdkcardigyylrivtyclvaggtgpldeyliagideinr tfdlspswyvealkyikanhglsgdardeansyldyainals
Timeline for d4f0ta_: