SCOPe 2.08: Domain d4f0tb_: 4f0t B:

Lineage for d4f0tb_ (4f0t B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [193921] (2 PDB entries)

8. Domain d4f0tb_: 4f0t B: [193923]
   automated match to d1gh0b_
   complexed with cyc

Details for d4f0tb_

PDB Entry: 4f0t, 2.25 Å

PDB Description: X-Ray Crystal Structure of Phycocyanin from Synechocystis sp. PCC 6803

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4f0tb_:

Sequence; same for both SEQRES and ATOM records:

>d4f0tb_ a.1.1.3 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mfdvftrvvsqadargeylsgsqldalsatvaegnkridsvnritgnasaivsnaaralf
aeqpqliqpggnaytsrrmaaclrdmeiilryvtyatftgdasvledrclnglretyval
gvpgasvaagvqkmkeaaldivndpngitrgdcsaivaeiagyfdraaaava

Timeline for d4f0tb_:

• d4f0tb_ first appeared in SCOPe 2.02
  
• d4f0tb_ appears in SCOPe 2.07