SCOPe 2.02: Domain d4f0uf_: 4f0u F:

Lineage for d4f0uf_ (4f0u F:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein automated matches [190531] (8 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)

8. Domain d4f0uf_: 4f0u F: [193922]
   automated match to d3dbjb_
   complexed with cyc

Details for d4f0uf_

PDB Entry: 4f0u, 2.5 Å

PDB Description: X-Ray Crystal Structure of Allophycocyanin from Synechococcus elongatus PCC 7942

PDB Compounds: (F:) Allophycocyanin, beta subunit

SCOPe Domain Sequences for d4f0uf_:

Sequence; same for both SEQRES and ATOM records:

>d4f0uf_ a.1.1.3 (F:) automated matches {Synechococcus elongatus [TaxId: 1140]}
mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
vpigatvqaiqaikevtaslvgpdagremgvyldyissgls

Timeline for d4f0uf_:

• d4f0uf_ is new in SCOPe 2.02-stable
  
• d4f0uf_ appears in SCOPe 2.03
  
• d4f0uf_ appears in the current release, SCOPe 2.08