Lineage for d4f0uf_ (4f0u F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689327Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)
  8. 2689357Domain d4f0uf_: 4f0u F: [193922]
    automated match to d3dbjb_
    complexed with cyc

Details for d4f0uf_

PDB Entry: 4f0u (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Allophycocyanin from Synechococcus elongatus PCC 7942
PDB Compounds: (F:) Allophycocyanin, beta subunit

SCOPe Domain Sequences for d4f0uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0uf_ a.1.1.3 (F:) automated matches {Synechococcus elongatus [TaxId: 1140]}
mqdaitavinasdvqgkyldssaldrlksyfqsgelrvraaatisansalivkeavaksl
lysditrpggnmyttrryaacirdleyylryatyamlagdtsildervlnglketynslg
vpigatvqaiqaikevtaslvgpdagremgvyldyissgls

SCOPe Domain Coordinates for d4f0uf_:

Click to download the PDB-style file with coordinates for d4f0uf_.
(The format of our PDB-style files is described here.)

Timeline for d4f0uf_: