Lineage for d4gy3b_ (4gy3 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077126Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1077171Species Thermosynechococcus vulcanus [TaxId:32053] [193917] (1 PDB entry)
  8. 1077172Domain d4gy3b_: 4gy3 B: [193918]
    Other proteins in same PDB: d4gy3a_
    automated match to d1jbob_
    complexed with cyc, ure

Details for d4gy3b_

PDB Entry: 4gy3 (more details), 2.5 Å

PDB Description: T. vulcanus Phycocyanin crystallized in 2M Urea
PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d4gy3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gy3b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d4gy3b_:

Click to download the PDB-style file with coordinates for d4gy3b_.
(The format of our PDB-style files is described here.)

Timeline for d4gy3b_: