SCOPe 2.08: Domain d4gy3b_: 4gy3 B:

Lineage for d4gy3b_ (4gy3 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (9 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [193917] (2 PDB entries)

8. Domain d4gy3b_: 4gy3 B: [193918]
   Other proteins in same PDB: d4gy3a_
   automated match to d1jbob_
   complexed with cyc, ure

Details for d4gy3b_

PDB Entry: 4gy3, 2.5 Å

PDB Description: T. vulcanus Phycocyanin crystallized in 2M Urea

PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d4gy3b_:

Sequence; same for both SEQRES and ATOM records:

>d4gy3b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d4gy3b_:

• d4gy3b_ first appeared in SCOPe 2.02
  
• d4gy3b_ appears in SCOPe 2.07