![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein Phycocyanin beta subunit [88940] (9 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [193917] (2 PDB entries) |
![]() | Domain d4gy3b_: 4gy3 B: [193918] Other proteins in same PDB: d4gy3a_ automated match to d1jbob_ complexed with cyc, ure |
PDB Entry: 4gy3 (more details), 2.5 Å
SCOPe Domain Sequences for d4gy3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gy3b_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus vulcanus [TaxId: 32053]} mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d4gy3b_: