Lineage for d4h0mp_ (4h0m P:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077042Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 1077200Protein automated matches [190531] (8 species)
    not a true protein
  7. 1077248Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)
  8. 1077250Domain d4h0mp_: 4h0m P: [193915]
    automated match to d1cpcb_
    complexed with cyc

Details for d4h0mp_

PDB Entry: 4h0m (more details), 2.2 Å

PDB Description: X-Ray Crystal Structure of Phycocyanin from Synechococcus elongatus sp. PCC 7942
PDB Compounds: (P:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4h0mp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0mp_ a.1.1.3 (P:) automated matches {Synechococcus elongatus [TaxId: 1140]}
tfdaftkvvaqadargeflsdaqldalsrlvaegnkridtvnritgnassivanaaralf
aeqpsliapggnaytnrrmaaclrdmeiilryvtyavftgdasilddrclnglretylal
gvpgasvaegvrkmkdaavaivsdrngitqgdcsaiiselgsyfdkaaaava

SCOPe Domain Coordinates for d4h0mp_:

Click to download the PDB-style file with coordinates for d4h0mp_.
(The format of our PDB-style files is described here.)

Timeline for d4h0mp_: